General Information

  • ID:  hor002260
  • Uniprot ID:  P81829
  • Protein name:  Leucokinin
  • Gene name:  Lk
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Kinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0008613 diuretic hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007589 body fluid secretion; GO:2000252 negative regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NSVVLGKKQRFHSWG
  • Length:  15(133-147)
  • Propeptide:  MAKIVLCMVLLAFGRQVYGASLVPAPISEQDPELATCELQLSKYRRFILQAILSFEDVCDAYSSRPGGQDSDSEGWPFRHYAPPPTSQRGEIWAFFRLLMAQFGDKEFSPIIRDAVIERCRIKSQLQRDEKRNSVVLGKKQRFHSWGGKRSPEPPILPDY
  • Signal peptide:  MAKIVLCMVLLAFGRQVYG
  • Modification:  T15 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts through intracellular calcium in Malpighian tubule stellate cells to raise chloride conductance.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81829-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002260_AF2.pdbhor002260_ESM.pdb

Physical Information

Mass: 199289 Formula: C79H123N25O20
Absent amino acids: ACDEIMPTY Common amino acids: GKSV
pI: 11.82 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -72 Boman Index: -2947
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 64.67
Instability Index: 1194.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 392.86

Literature

  • PubMed ID:  10574744
  • Title:  Isolation and characterization of a leucokinin-like peptide of Drosophila melanogaster.
  • PubMed ID:  12171930
  • Title:  Peptidomics of the larval Drosophila melanogaster central nervous system.